Invitrogen™ Human PAXBP1 (aa 207-341) Control Fragment Recombinant Protein

Product Code. 30197231

Brand: Invitrogen™ RP100751

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52002 (PA5-52002. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that may bind to GC-rich DNA sequences, which suggests its involvement in the regulation of transcription. Alternative splicing of this gene results in multiple transcript variants.

Specifications

• Accession Number: Q9Y5B6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 94104
• Name: Human PAXBP1 (aa 207-341) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810007M14Rik; BM020; C21orf66; FSAP105; functional spliceosome-associated protein 105; Gcfc; GCFC1; GC-rich sequence DNA binding factor 1; GC-rich sequence DNA-binding factor 1; GC-rich sequence DNA-binding factor candidate; GC-rich sequence DNA-binding factor homolog; PA x 3 and PA x 7 binding protein 1; PA x 3- and PA x 7-binding protein 1; PA x 3/7 BP; Paxbp1
• Common Name: PAXBP1
• Gene Symbol: PAXBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining