Invitrogen™ Human PAX2 (aa 268-332) Control Fragment Recombinant Protein

Product Code. 30195964

Brand: Invitrogen™ RP100893

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The pax genes are a family of transcription factors that are active in specific tissues during early embryonic development. Pax family members possess a DNA-binding domain encoded by the paired box. Because paired domain containing genes encode transcription factors, they are capable of executing a genetic program. Several pax genes have also been associated with developmental mutations including: pax-3, which is associated with Waardenburg syndrome, pax-6, which is associated with Aniridia, and pax-2, which is associated with Wilms tumor. During embryogenesis, Pax-2 is expressed in the developing kidney. In particular, the pax-2 gene is expressed in condensing metanephric mesenchyme and in early epithelial structures derived from mesenchyme; however, pax-2 mRNA and protein levels are rapidly down regulated as the tubular epithelium matures. Although Pax-2 is down regulated during renal epithelium maturation, Pax-2 expression persists in the undifferentiated epithelium of Wilms' tumors. Persistent expression of Pax-2 in Wilms' tumors occurs frequently and correlates with the proliferation of poorly differentiated epithelial cells in these tumors. Interestingly, expression of the Wilms' tumor suppresser protein, WT1, coincides with down-regulation of the pax-2 gene; thus, suggesting that WT1 can directly repress pax-2 transcription.

Specifications

• Accession Number: Q02962
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5076
• Name: Human PAX2 (aa 268-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FSGS7; Opdc; optic disc coloboma; paired box 2; paired box gene 2; paired box homeotic gene 2; paired box protein Pax-2; PAPRS; PAX2; Pax-2
• Common Name: PAX2
• Gene Symbol: PAX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining