Invitrogen™ Human PATL1 (aa 360-457) Control Fragment Recombinant Protein

Product Code. 30198652

Brand: Invitrogen™ RP97452

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding protein involved in deadenylation-dependent decapping of mRNAs, leading to the degradation of mRNAs. Acts as a scaffold protein that connects deadenylation and decapping machinery. Required for cytoplasmic mRNA processing body (P-body) assembly. In case of infection, required for translation and replication of hepatitis C virus (HCV).

Specifications

• Accession Number: Q86TB9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219988
• Name: Human PATL1 (aa 360-457) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV312086; hPat1b; OK/KNS-cl0.5; PAT1 homolog 1, processing body mRNA decay factor; Pat1b; PAT1-like protein 1; PATL1; protein associated with topoisomerase II homolog 1; protein associated with topoisomerase II homolog 1 (yeast); protein PAT1 homolog 1; Protein PAT1 homolog b; RGD1305514
• Common Name: PATL1
• Gene Symbol: Patl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining