Invitrogen™ Human PASD1 (aa 322-464) Control Fragment Recombinant Protein

Product Code. 30210400

Brand: Invitrogen™ RP92228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (24%), Rat (24%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52793 (PA5-52793. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is thought to function as a transcription factor. The protein is a cancer-associated antigen that can stimulate autologous T-cell responses, and it is therefore considered to be a potential immunotherapeutic target for the treatment of various hematopoietic malignancies, including diffuse large B-cell lymphoma.

Specifications

• Accession Number: Q8IV76
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 139135
• Name: Human PASD1 (aa 322-464) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cancer/testis antigen 63; circadian clock protein PASD1; CT63; Gm1141; OXTES1; OX-TES-1; PAS domain containing 1; PAS domain-containing protein 1; PASD1; predicted gene 1141
• Common Name: PASD1
• Gene Symbol: PASD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQPSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVVIPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining