Invitrogen™ Human PARP6 (aa 497-579) Control Fragment Recombinant Protein

Product Code. 30201827

Brand: Invitrogen™ RP90670

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55475 (PA5-55475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. Poly(ADP-ribose) polymerases (PARPs) now constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.

Specifications

• Accession Number: Q2NL67
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56965
• Name: Human PARP6 (aa 497-579) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700119G14Rik; 2310028P13Rik; 3110038K10Rik; ADP-ribosyltransferase diphtheria toxin-like 17; ARTD17; C030013N01Rik; PARP6; PARP-6; PARP-6-B1; PARP-6-C; pART17; poly (ADP-ribose) polymerase family, member 6; poly [ADP-ribose] polymerase 6; poly(ADP-ribose) polymerase family member 6; Protein mono-ADP-ribosyltransferase PARP6; RGD1310937
• Common Name: PARP6
• Gene Symbol: Parp6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining