missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212941

Invitrogen™ Human PARP2 (aa 14-136) Control Fragment Recombinant Protein

Product Code. 30212941
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212941

Brand: Invitrogen™ RP88871

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes polytransferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UGN5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10038
Name Human PARP2 (aa 14-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ADP-ribosyltransferase (NAD+, poly(ADP-ribose) polymerase)-like 2; ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) 2; ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2; ADP-ribosyltransferase diphtheria toxin-like 2; ADPRT2; ADPRT-2; ADPRTL2; ADPRTL3; ARTD2; Aspartl2; C78626; DNA ADP-ribosyltransferase PARP2; HGNC:272; hPARP-2; mPARP-2; NAD(+) ADP-ribosyltransferase 2; pADPRT-2; parp 2; PARP2; PARP-2; poly (ADP-ribose) polymerase 2; poly (ADP-ribose) polymerase family, member 2; poly (ADP-ribosyl) transferase-like 2; poly [ADP-ribose] polymerase 2; poly(ADP-ribose) polymerase 2; poly[ADP-ribose] synthase 2; poly[ADP-ribose] synthetase 2; Protein poly-ADP-ribosyltransferase PARP2
Common Name PARP2
Gene Symbol PARP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.