missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207793

Invitrogen™ Human PARP14 (aa 1521-1641) Control Fragment Recombinant Protein

Product Code. 30207793
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207793

Brand: Invitrogen™ RP89867

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82454 (PA5-82454. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Poly [ADP-ribose] polymerase 14 (PARP14) is a B aggressive lymphoma protein belonging to the PARP protein family. Poly ADP ribosylation is a DNA damage dependent post translational modification of histones and other nuclear proteins that mediates DNA repair. PARP proteins with a macrodomain are also involved in gene expression through transcriptional regulation. PARP14 controls STAT6 dependent transcription by enhancing binding to the promoter in the presence of a positive signal (i.e. IL4 stimulation).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q460N5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54625
Name Human PARP14 (aa 1521-1641) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1600029O10Rik; ADP-ribosyltransferase diphtheria toxin-like 8; ARTD8; B aggressive lymphoma protein 2; B-aggressive lymphoma 2; BAL2; BC021340; CoaSt6; Collaborator of STAT6; KIAA1268; mKIAA1268; Parp14; PARP-14; pART8; poly (ADP-ribose) polymerase family, member 14; poly [ADP-ribose] polymerase 14; poly(ADP-ribose) polymerase family member 14; Protein mono-ADP-ribosyltransferase PARP14; protein mono-ADP-ribosyltransferase PARP14; poly [ADP-ribose] polymerase 14; RGD1310490; Unknown (protein for IMAGE:8227979)
Common Name PARP14
Gene Symbol PARP14
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.