Invitrogen™ Human PARP1 (aa 548-686) Control Fragment Recombinant Protein

Product Code. 30197422

Brand: Invitrogen™ RP89486

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Poly ADP-Ribose Polymerase (PARP) uses nicotinamide adenine dinucleotide (oxidized form) NAD as a substrate to catalyse the transfer of ADP-ribose to a variety of nuclear protein acceptors. Proteolysis of PARP to its stable 85kDa fragment is an early marker of programmed cell death (apoptosis) and is mediated by the caspase CPP32 protein. Cleavage occurs between Adp216 and Gly217, a site in PARP conserved across species.

Specifications

• Accession Number: P09874
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 142
• Name: Human PARP1 (aa 548-686) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830444G22Rik; ADP-ribosyltransferase (NAD+; ADP-ribosyltransferase (NAD+) poly (ADP-ribose) polymerase); ADP-ribosyltransferase (NAD+, poly (ADP-ribose) polymerase) 1; ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase); ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) 1; ADP-ribosyltransferase 1; ADP-ribosyltransferase diphtheria toxin-like 1; ADP-ribosyltransferase NAD(+); Adprp; Adprt; ADPRT 1; Adprt1; AI893648; ARTD1; C80510; DNA ADP-ribosyltransferase PARP1; I79_014850; msPARP; NAD(+) ADP-ribosyltransferase 1; NAD(+) pADPRT-1; pADPRT-1; PARP; PARP1; PARP-1; poly (ADP-ribose) polymerase 1; poly (ADP-ribose) polymerase family, member 1; poly (ADP-ribose) polymerase); poly [ADP-ribose] polymerase 1; poly ADP-ribose polymerase; poly(ADP-ribose) polymerase; poly(ADP-ribose) polymerase 1; poly(ADP-ribose) polymerase PARP-1; poly(ADP-ribose) synthetase; poly(ADP-ribosyl)transferase; Poly[ADP-ribose] synthase 1; poly[ADP-ribose] synthetase 1; PPOL; Protein poly-ADP-ribosyltransferase PARP1; sPARP-1; synthetase fragment (AA 67); Unknown (protein for IMAGE:8023736); unnamed protein product
• Common Name: PARP1
• Gene Symbol: Parp1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining