Invitrogen™ Human PARM1 (aa 36-129) Control Fragment Recombinant Protein

Product Code. 30195196

Brand: Invitrogen™ RP96730

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58307 (PA5-58307. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PARM1 may regulate TLP1 expression and telomerase activity, thus enabling certain prostatic cells to resist apoptosis.

Specifications

• Accession Number: Q6UWI2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25849
• Name: Human PARM1 (aa 36-129) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: castration-induced prostatic apoptosis-related protein 1; Cipar1; DKFZP564O0823; PARM1; PARM-1; Prostate androgen-regulated mucin-like protein 1; prostatic androgen-regulated mucin-like protein 1; prostatic androgen-repressed message 1; prostatic androgen-repressed message-1; UNQ1879/PRO4322; WSC4; WSC4, cell wall integrity and stress response component 4 homolog
• Common Name: PARM1
• Gene Symbol: PARM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining