Invitrogen™ Human Parkin (aa 301-378) Control Fragment Recombinant Protein

Product Code. 30198037

Brand: Invitrogen™ RP108345

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The precise function of Parkin gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.

Specifications

• Accession Number: O60260
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5071
• Name: Human Parkin (aa 301-378) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AAN12155.1; AR-JP; CG10523; CG10523-PB; CG10523-PC; Dmel\CG10523; Dmel_CG10523; Dpark; dParkin; D-parkin; dpk; E3 ubiquitin ligase; E3 ubiquitin-protein ligase parkin; LPRS2; OTTHUMP00000017562; OTTHUMP00000017563; OTTHUMP00000017564; park; park1; PARK2; Parkin; parkin 2; parkin F; Parkin isoform 1; parkin protein; parkin RBR E3 ubiquitin protein ligase; Parkin RBR E3 ubiquitin-protein ligase; parkin variant SV5DEL; Parkinson disease (autosomal recessive, juvenile) 2, parkin; Parkinson disease protein 2; Parkinson juvenile disease protein 2; parkinson protein 2 E3 ubiquitin protein ligase; parkinson protein 2, E3 ubiquitin protein ligase; parkinson protein 2, E3 ubiquitin protein ligase (parkin); park-PB; park-PC; PDJ; Pk.; Prkn; SD01679
• Common Name: Parkin
• Gene Symbol: PRKN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining