Invitrogen™ Human PARD6B (aa 77-158) Control Fragment Recombinant Protein

Product Code. 30201327

Brand: Invitrogen™ RP90744

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53050 (PA5-53050. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Specifications

• Accession Number: Q9BYG5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84612
• Name: Human PARD6B (aa 77-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV025615; par-6 (partitioning defective 6) homolog beta; PAR-6 beta; par-6 family cell polarity regulator beta; par-6 partitioning defective 6 homolog beta; par-6 partitioning defective 6 homolog beta (C. elegans); PAR6B; PAR-6 B; Pard6b; pard6beta; partitioning defective 6 beta; partitioning defective 6 homolog beta; partitioning-defective protein 6, beta; si:dkey-192i18.6
• Common Name: PARD6B
• Gene Symbol: Pard6b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining