missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PARD3 (aa 1017-1108) Control Fragment Recombinant Protein

Product Code. 30213287
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213287

Brand: Invitrogen™ RP94754

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56475 (PA5-56475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the kinesin 4 or subfamily of kinesin related proteins. This subfamily is also referred to as the chromokinesins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TEW0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56288
Name Human PARD3 (aa 1017-1108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA960621; AI256638; ASBP; ASIP; atypical PKC isotype-specific interacting protein; atypical PKC isotype-specific-interacting protein; atypical PKC-specific binding protein; atypical PKC-specific-binding protein; Baz; bazooka; CTCL tumor antigen se2-5; D8Ertd580e; Ephrin-interacting protein; FLJ21015; PAR3; Par-3; par-3 (partitioning defective 3) homolog; par-3 family cell polarity regulator; par-3 family cell polarity regulator alpha; par-3 partitioning defective 3 homolog; PAR3A; PAR3alpha; PAR3-alpha; Pard3; PARD-3; PARD3A; partitioning defective 3 homolog; partitioning-defective 3 homolog; PHIP; PPP1R118; protein phosphatase 1, regulatory subunit 118; RP11-406D17.1; SE2-5L16; SE2-5 LT1; SE2-5T2; three-PDZ containing protein similar to C. elegans PAR3 (partitioning defect)
Common Name PARD3
Gene Symbol Pard3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.