missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193959

Invitrogen™ Human PAR6 (aa 284-345) Control Fragment Recombinant Protein

Product Code. 30193959
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193959

Brand: Invitrogen™ RP102911

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 domain and a semi-Cdc42/Rac interactive binding domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NPB6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 50855
Name Human PAR6 (aa 284-345) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0710008C04Rik; 2610010A15Rik; PAR6; Par-6; par-6 (partitioning defective 6,) homolog alpha; PAR-6 alpha; par-6 family cell polarity regulator alpha; par-6 partitioning defective 6 homolog alpha; PAR6A; PAR-6 A; PAR6alpha; PAR6C; Pard6a; Partitioning defective 6 homolog alpha; partitioning defective protein 6 A; partitioning defective-6 homolog alpha; partitioning-defective protein 6; similar to Partitioning defective-6 homolog alpha (PAR-6 alpha) (PAR-6 A) (PAR-6) (PAR6C) (Tax interaction protein 40) (TIP-40); tax interaction protein 40; TA x 40; Tax-interacting protein 40; Tip-40
Common Name PAR6
Gene Symbol PARD6A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.