missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204679

Invitrogen™ Human PAQR6 (aa 146-225) Control Fragment Recombinant Protein

Product Code. 30204679
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204679

Brand: Invitrogen™ RP105580

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67298 (PA5-67298. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plasma membrane progesterone (P4) receptor coupled to G proteins (PubMed:23763432, PubMed:23161870). Seems to act through a G(s) mediated pathway (PubMed:23161870). Involved in neurosteroid inhibition of apoptosis (PubMed:23161870). May be involved in regulating rapid P4 signaling in the nervous system (PubMed:23763432). Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone (PubMed:23763432, PubMed:23161870). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6TCH4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79957
Name Human PAQR6 (aa 146-225) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500001B10Rik; FLJ22672; LOW QUALITY PROTEIN: membrane progestin receptor delta; LOW QUALITY PROTEIN: progestin and adipoQ receptor family member 6; Membrane progesterone P4 receptor delta; Membrane progesterone receptor delta; Membrane progestin receptor delta; MGC137682 protein; mPR delta; Paqr6; PRdelta; Progesterone and adipoQ receptor family member 6; Progestin and adipoQ receptor family member 6; progestin and adipoQ receptor family member VI; progestin and adipoQ receptor family member VI variant 3; progestin and adipoQ receptor family member VI variant 4; progestin and adipoQ receptor family member VI variant 5
Common Name PAQR6
Gene Symbol PAQR6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.