missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PAPSS1 (aa 221-272) Control Fragment Recombinant Protein

Codice prodotto. 30204794
Click to view available options
Quantity:
100 μL
Dimensione della confezione:
100µL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 30204794

Marca: Invitrogen™ RP100406

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83976 (PA5-83976. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 ). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number O43252
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9061
Name Human PAPSS1 (aa 221-272) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3'-phosphoadenosine 5'-phosphosulfate synthase 1; 3'-phosphoadenosine-5'-phosphosulfate synthase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1; Adenosine-5'-phosphosulfate 3'-phosphotransferase; Adenylylsulfate 3'-phosphotransferase; Adenylyl-sulfate kinase; AI325286; APS kinase; Asapk; ATPSK1; ATP-sulfurylase; bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1; PAPS synthase 1; PAPS Synthetase 1; PAPSS; PAPSS 1; PAPSS1; SAT; SK 1; SK1; Sulfate adenylate transferase; Sulfate adenylyltransferase; sulfurylase kinase 1
Common Name PAPSS1
Gene Symbol PAPSS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato