Invitrogen™ Human PAPSS1 (aa 221-272) Control Fragment Recombinant Protein

Codice prodotto. 30204794

Marca: Invitrogen™ RP100406

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83976 (PA5-83976. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 ). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2.

Specifica

• Accession Number: O43252
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9061
• Name: Human PAPSS1 (aa 221-272) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3'-phosphoadenosine 5'-phosphosulfate synthase 1; 3'-phosphoadenosine-5'-phosphosulfate synthase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1; Adenosine-5'-phosphosulfate 3'-phosphotransferase; Adenylylsulfate 3'-phosphotransferase; Adenylyl-sulfate kinase; AI325286; APS kinase; Asapk; ATPSK1; ATP-sulfurylase; bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1; PAPS synthase 1; PAPS Synthetase 1; PAPSS; PAPSS 1; PAPSS1; SAT; SK 1; SK1; Sulfate adenylate transferase; Sulfate adenylyltransferase; sulfurylase kinase 1
• Common Name: PAPSS1
• Gene Symbol: PAPSS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining