missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194206

Invitrogen™ Human PAPPA2 (aa 410-485) Control Fragment Recombinant Protein

Product Code. 30194206
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194206

Brand: Invitrogen™ RP91868

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53798 (PA5-53798. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLAC3 (placenta-specific protein 3), also known as PAPP-A2, is a metalloproteinase that cleaves the insulin-like growth factor-binding protein (IGFBP)-5 in a IGF-independent fashion. It has been suggested that the cleavage of IGFBP-5 and to a lesser extent IGFBP-3 produced in the maternal decidua promotes feto-placental growth. Recent studies have shown elevated levels of PLAC3 in hypertensive disorders of pregnancy including preeclampsia and HELLP (hemolysis, elevated liver enzymes, and low platelets) syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BXP8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60676
Name Human PAPPA2 (aa 410-485) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LOC680415; PAPPA2; PAPP-A2; pappalysin 2; pappalysin-2; Pappe; PAPP-E; PLAC3; placenta-specific 3; pregnancy-associated plasma preproprotein-A2; Pregnancy-associated plasma protein A2; Pregnancy-associated plasma protein E1; pregnancy-associated plasma protein-E; RP4-774I24.1; similar to pappalysin 2 isoform 1
Common Name PAPPA2
Gene Symbol PAPPA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLQGFE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.