Invitrogen™ Human PAPOLB (aa 576-637) Control Fragment Recombinant Protein

Product Code. 30196855

Brand: Invitrogen™ RP100889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140312 (PA5-140312. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Testis-specific poly(A) polymerase.

Specifications

• Accession Number: Q9NRJ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56903
• Name: Human PAPOLB (aa 576-637) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Med21; PAP; PAP-beta; Paplob; Papola-ps; PAPOLB; PAPT; Plap-ps; poly (A) polymerase beta (testis specific); poly(A) polymerase beta; poly(A) polymerase beta (testis specific); polynucleotide adenylyltransferase beta; Testis-specific poly(A) polymerase; TPAP
• Common Name: PAPOLB
• Gene Symbol: PAPOLB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining