missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PAPL (aa 134-211) Control Fragment Recombinant Protein

Product Code. 30180770
Click to view available options
Quantity:
100 μL
Pakningsstørrelse:
100µL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30180770

Brand: Invitrogen™ RP99189

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59817 (PA5-59817. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q6ZNF0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 390928
Name Human PAPL (aa 134-211) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acid phosphatase 7, tartrate resistant (putative); acid phosphatase type 7; acp7; iron/zinc purple acid phosphatase-like protein; PAPL; PAPL1; Purple acid phosphatase long form; purple acid phosphatase long form 1; zgc:162913
Common Name PAPL
Gene Symbol ACP7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.