Invitrogen™ Human PAM (aa 240-385) Control Fragment Recombinant Protein

Product Code. 30195882

Brand: Invitrogen™ RP88689

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59929 (PA5-59929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNX33 (sorting nexin-33), also known as SH3PX3, SH3PXD3C or SNX30, is a 574 amino acid protein that interacts with ADAM15 and FAS-L. Belonging to the sorting nexin family, SNX33 contains one BAR domain, one PX (phox homology) domain and one SH3 domain. The gene that encodes SNX33 consists of over 14,000 bases and maps to human chromosome 15q24.2. Housing approximately 106 million base pairs and encoding more than 700 genes, chromosome 15 makes up about 3% of the human genome. Angelman and Prader-Willi syndromes are associated with loss of function or deletion of genes in the 15q11-q13 region.

Specifications

• Accession Number: P19021
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5066
• Name: Human PAM (aa 240-385) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU023734; AW107953; AW546647; C130061D10Rik; E3 ubiquitin-protein ligase MYCBP2; Highwire; KIAA0916; MYC binding protein 2; MYC binding protein 2, E3 ubiquitin protein ligase; Myc-binding protein 2; Mycbp2; Myc-bp2; PAL; PAM; pam, highwire, rpm 1; pam/highwire/rpm-1 protein; pancreatic peptidylglycine alpha-amidating monooxygenase; peptidyl alpha-amidating enzyme; peptidyl-alpha-hydroxyglycine alpha-amidating lyase; peptidylamidoglycolate lyase; peptidylglycine 2-hydroxylase; Peptidyl-glycine alpha-amidating monooxygenase; peptidylglycine alpha-amidating monooxygenase; PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASE PRECURSOR (PAM); Peptidylglycine alpha-hydroxylating monooxygenase; PHM; Phr; Phr1; probable E3 ubiquitin-protein ligase MYCBP2; protein associated with Myc; Protein Magellan; R75243
• Common Name: PAM
• Gene Symbol: PAM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPPEANIPIPVKSDMVMMHEHHKETEYKDKIPLLQQPKREEEEVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining