Invitrogen™ Human PAIP2 (aa 2-35) Control Fragment Recombinant Protein

Product Code. 30203035

Brand: Invitrogen™ RP103268

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63347 (PA5-63347. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. Displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization.

Specifications

• Accession Number: Q9BPZ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51247
• Name: Human PAIP2 (aa 2-35) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310050K10Rik; AU045972; HSPC218; MGC72018; PABC1-interacting protein 2; Pabp-interacting protein 2; PAIP2; PAIP-2; PAIP2A; poly(A) binding protein interacting protein 2; poly(A)-binding protein-interacting protein 2; polyA-binding protein-interacting protein 2; polyadenylate-binding protein interacting protein 2; polyadenylate-binding protein-interacting protein 2
• Common Name: PAIP2
• Gene Symbol: PAIP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining