Invitrogen™ Human PAGR1 (aa 79-154) Control Fragment Recombinant Protein

Product Code. 30182519

Brand: Invitrogen™ RP98796

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59574 (PA5-59574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Steroid receptor co-activators (SRCs) were initially described as nuclear receptor transcription co-activators, but they have recently been determined to co-regulate transcription initiated by other transcription factors. GAS is a recently identified glutamate-rich protein that interacts with SRC1, but not GRIP1 or AIB1, the other two members of the SRC family. GAS can also interact with the alpha subunit of the estrogen receptor (ERalpha), but not other receptors such as the retinoic acid receptor a, suggesting the interaction between GAS and ERalpha is relatively specific. Depletion of GAS by RNA interference in MCF7 cells led to a decrease in the mRNA and protein levels of ER target genes such as pS2, c-Myc and cyclin D1, indicating the role of GAS in the regulation of ER target genes. GAS has also been found to associate with an SET1-like methyltransferase complex specific for H3K4 methylation, suggesting that GAS has multiple roles in transcriptional regulation.

Specifications

• Accession Number: Q9BTK6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79447
• Name: Human PAGR1 (aa 79-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900092E17Rik; C16orf53; C77040; GAS; glutamate-rich coactivator associated with SRC1; glutamate-rich coactivator interacting with SRC1; glutamate-rich coactivator interacting with SRC1/NCOA1; PA1; Pagr; PAGR1; Pagr1a; PAXIP1 associated glutamate rich protein 1; PAXIP1 associated glutamate rich protein 1 A; PAXIP1 associated glutamate-rich protein 1; PAXIP1-associated glutamate-rich protein 1; PAXIP1-associated glutamate-rich protein 1 A; PAXIP1-associated protein 1; PTIP-associated 1; PTIP-associated 1 protein; PTIP-associated protein 1
• Common Name: PAGR1
• Gene Symbol: PAGR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining