Invitrogen™ Human PACSIN2 (aa 346-399) Control Fragment Recombinant Protein

Product Code. 30211624

Brand: Invitrogen™ RP101143

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83983 (PA5-83983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PACSIN 2, a 486 AA phosphoprotein is a novel member of the PACSIN family of cytoplasmic adapter proteins. It is an isoform of PACSIN with a CDC15 N-terminal domain, a C-terminal SH3 domain, 3 conserved regions specific to the PACSIN family, and 3 asn-pro-phe (NPF) motifs, which potentially bind to EH domains. This protein is known to display a ubiquitous expression pattern with the highest levels of expression in brain. Reports suggest that PACSIN 2 participates in the organization of the actin cytoskeleton, the regulation of vesicular traffic. It also participates in endocytic internalization and endocytic receptor recycling.

Specifications

• Accession Number: Q9UNF0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11252
• Name: Human PACSIN2 (aa 346-399) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI197433; cytoplasmic phosphoprotein PACSIN2; Pacsin2; pacsin2.S; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons 2 protein; protein kinase C and casein kinase substrate in neurons 2 S homeolog; protein kinase C and casein kinase substrate in neurons protein 2; RP3-437M21.1; SdpII; SdpIIsyndapin II; synaptic dynamin-associated protein II; syndapin 2; Syndapin II; syndapin2; syndapin-2; Syndapin-II; XELAEV_18019736mg; x-PACSIN2
• Common Name: PACSIN2
• Gene Symbol: PACSIN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining