Invitrogen™ Human PACAP Receptor Control Fragment Recombinant Protein

Product Code. 30210494

Brand: Invitrogen™ RP108337

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Alternative splicing of two exons of this gene generates four major splice variants, but their full-length nature has not been determined. PACAP receptor type 1 expression has been documented in adipose, adrenal, bone, brain, colon, ganglion, heart, lung, ovary, pancreas, placenta, spleen, and uterus. ESTs have been isolated from brain and nerve libraries.

Specifications

• Accession Number: P41586
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 117
• Name: Human PACAP Receptor Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900024I10Rik; ADCYAP receptor type I; ADCYAP1 R1; ADCYAP1R 1; Adcyap1r1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; adenylate cyclase activating polypeptide 1 receptor 1; adenylate cyclase activating polypeptide 1 type 1 receptor; AI846590; alternatively spliced product of PACAP receptor; G-protein coupled receptor; PAC 1; PAC1; PAC1 receptor; Pac1 receptors; PAC1R; PAC1-R; PACAP R 1; PACAP Receptor; PACAP receptor 1; PACAP type I receptor; PACAP type IA receptor; PACAP/VIP receptors; PACAP1 R; PACAP1 receptor; PACAP1-R; PACAPR; PACAPR1; PACAP-R1; PACAP-R-1; PACAPR1A; PACAP-R1A; PACAP-R-1 A; PACAPRI; pituitary adenylate cyclase activating polypeptide 1 receptor; pituitary adenylate cyclase activating polypeptide 1 receptor (1); pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop; pituitary adenylate cyclase activating polypeptide receptor; pituitary adenylate cyclase-activating polypeptide type 1 receptor; pituitary adenylate cyclase-activating polypeptide type 1 receptor hop 1 splice variant; pituitary adenylate cyclase-activating polypeptide type I receptor; pituitary adenylate cyclase-activating polypeptide type IA receptor; pvr1
• Common Name: PACAP Receptor
• Gene Symbol: ADCYAP1R1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining