Invitrogen™ Human p70 S6 Kinase (aa 446-516) Control Fragment Recombinant Protein

Product Code. 30208229

Brand: Invitrogen™ RP102872

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83463 (PA5-83463. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KB1 (p70S6K) is a serine/threonine kinase with 2 non-identical kinase catalytic domains which phosphorylates several residues of the S6 ribosomal protein. p70 S6 kinase is predominantly localized in the cytoplasm, and is essential in growth factors regulated cell proliferation, pathways involving cell motility, such as metastases, the immune response, and tissue repair. p70 S6 kinase acts downstream of phosphoinositide (PI) 3-kinase, and its main physiological target is the S6 ribosomal protein, which is involved in upregulation of protein synthesis. The kinase activity of p70 S6 kinase leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding p70 S6 kinase and overexpression are seen in some breast cancer cell lines.

Specifications

• Accession Number: P23443
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6198
• Name: Human p70 S6 Kinase (aa 446-516) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 10539; 2610318I15Rik; 4732464A07Rik; 70 kDa ribosomal protein S6 kinase 1; 7084; 70 kDa; 7-10; AA959758; AI256796; AI314060; CG10539; CG10539-PA; CG10539-PB; Dmel\CG10539; Dmel_CG10539; Dp70[s6k]; Dp70S6k; dps6k; dS6 kinase; dS6K; d-S6K; dS6K1; EC 2.7.11.1; fs(3)07084; hypothetical protein; kinase p70S6K; KS6B1; l(3)07084; p70 p70-S6K; p70 ribosomal S6 kinase; p70 ribosomal S6 kinase alpha; p70 S6 kinase; p70 S6 kinase 1; p70 S6 kinase alpha; p70 S6 kinase, alpha; p70 S6K; p70 S6KA; p70 S6K-alpha; p70(S6K)-alpha; p70/85s6k; p70/S6K; p70[S6 kinase]; p70[S6k]; p70[S6kinase]; p70-alpha; p70S6 kinase; p70S6k; p70-S6K; p70-S6K 1; p70S6K kinase; p70s6k protein kinase homolog; P70S6K1; p70S6K-alpha; p80-S6K 1; p85 p85S6K; Pk.?6; Pk64F; protein kinase-like 64 F; PS6K; p-S6K; ribosomal protein S6 kinase; ribosomal protein S6 kinase B1; ribosomal protein S6 kinase beta-1; Ribosomal protein S6 kinase I; ribosomal protein S6 kinase polypeptide 1; ribosomal protein S6 kinase, 70 kD, polypeptide 1; ribosomal protein S6 kinase, 70 kDa, polypeptide 1; ribosomal protein S6 kinase, polypeptide 1; ribosomal S6 protein kinase; Rps6kb1; RPS6-p70-protein kinase; S6 K; S6 kinase; s6k; S6K kinase; S6K1; s6k11; S6K-beta-1; S6kinase; S6-kinase; S6k-PA; S6k-PB; serine/threonine kinase 14 alpha; serine/threonine-protein kinase 14 A; STK14A
• Common Name: p70 S6 Kinase
• Gene Symbol: RPS6KB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining