Invitrogen™ Human p53AIP1 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30194718

Brand: Invitrogen™ RP92036

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60670 (PA5-60670. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The novel protein p53AIP, p53-regulated apoptosis-inducing protein 1, has been identified from the direct cloning of p53 binding sequences from human genomic DNA. The expression of p53AIP1 in mitochondria is induced by wild-type p53, which leads to apoptotic cell death through dissipation of mitochondrial Dym. Severe DNA damage causes the phosphorylation of p53 at Ser-46, p53AIP1 expression, and apoptotic cell death. DNA damage-inducible apoptotic cell death was enhanced through transcriptional activation of p53AIP1. P53R2 is directly regulated by p53 for supplying nucleotides to repair damaged DNA, thus plays a pivotal role in cell survival by repairing damaged DNA in the nucleus and that dysfunction of this pathway might result in activation of p53 dependent apoptosis to eliminate dangerous cells. In the opposite, p53AIP1 is likely to play an important role in mediating p53-dependent apoptosis, and phosphorylation of Ser46 regulates the transcriptional activation of this apoptosis inducing gene.

Specifications

• Accession Number: Q9HCN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63970
• Name: Human p53AIP1 (aa 1-62) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: p53AIP1; p53-regulated apoptosis-inducing protein 1; TP53AIP1; tumor protein p53 regulated apoptosis inducing protein 1
• Common Name: p53AIP1
• Gene Symbol: TP53AIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining