missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human p53AIP1 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30194718
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30194718 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194718 Supplier Invitrogen™ Supplier No. RP92036

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60670 (PA5-60670. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The novel protein p53AIP, p53-regulated apoptosis-inducing protein 1, has been identified from the direct cloning of p53 binding sequences from human genomic DNA. The expression of p53AIP1 in mitochondria is induced by wild-type p53, which leads to apoptotic cell death through dissipation of mitochondrial Dym. Severe DNA damage causes the phosphorylation of p53 at Ser-46, p53AIP1 expression, and apoptotic cell death. DNA damage-inducible apoptotic cell death was enhanced through transcriptional activation of p53AIP1. P53R2 is directly regulated by p53 for supplying nucleotides to repair damaged DNA, thus plays a pivotal role in cell survival by repairing damaged DNA in the nucleus and that dysfunction of this pathway might result in activation of p53 dependent apoptosis to eliminate dangerous cells. In the opposite, p53AIP1 is likely to play an important role in mediating p53-dependent apoptosis, and phosphorylation of Ser46 regulates the transcriptional activation of this apoptosis inducing gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HCN2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 63970
Name Human p53AIP1 (aa 1-62) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias p53AIP1; p53-regulated apoptosis-inducing protein 1; TP53AIP1; tumor protein p53 regulated apoptosis inducing protein 1
Common Name p53AIP1
Gene Symbol TP53AIP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.