Invitrogen™ Human p53 (aa 5-64) Control Fragment Recombinant Protein

Product Code. 30208841

Brand: Invitrogen™ RP109040

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The tumor suppressor protein, p53, is a sequence specific transcription factor that is activated by cellular stress. p53 mediates cell cycle arrest or apoptosis in response to DNA damage or starvation for pyrimidine nucleotides. p53 is up-regulated in response to stress signals and stimulated to activate transcription of specific genes, resulting in expression of p21waf1 and other proteins involved in G1 or G2/M arrest. The structure of p53 comprises an N-terminal transactivation domain, a central DNA-binding domain, an oligomerisation domain, and a C-terminal regulatory domain. There are various phosphorylation sites on p53, of which the phosphorylation at Ser15 is important for p53 activation and stabilization. p53 has been characterized to play a role in blocking the proliferative action of damaged cells and act as an anticancer agent. Phosphorylation of Ser392 in p53 has been shown to associate with the formation of human tumors. In addition, p53 has also been linked to the effects of aging and oxidative stress and an increase in p53 has been linked to deficits in LTP (Long Term Potentiation) in learning and memory. p53 is found in very low levels in normal cells, however, in a variety of transformed cell lines, it is expressed in high amounts, and believed to contribute to transformation and malignancy. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and cause the loss of tumor suppressor activity. Alterations of the TP53 gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families such as Li-Fraumeni syndrome.

Specifications

• Accession Number: P04637
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7157
• Name: Human p53 (aa 5-64) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Antigen NY-CO-13; bbl; BCC7; bfy; bhy; cellular tumor antigen p53; Cys 51 Stop; EGK_08142; FLJ92943; HGNC11998; I79_002739; LFS1; Li-Fraumeni syndrome; mutant p53; mutant tumor protein 53; OTTMUSP00000006194; p44; p53; p53 cellular tumor antigen; p53 protein; p53 tumor suppressor; p53 tumor suppressor phosphoprotein; phosphoprotein p53; Tp53; tp53.L; transformation related protein 53; transformation-related protein 53; Trp248; Trp53; tumor protein 53; tumor protein p53; tumor protein p53 (Li-Fraumeni syndrome); tumor protein p53 L homeolog; tumor suppressor p53; tumor suppressor p53 phosphoprotein; tumor suppressor protein p53; tumor supressor p53; Tumour Protein p53; XELAEV_180196761mg; Xp53; Xrel3
• Common Name: p53
• Gene Symbol: Tp53
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining