Invitrogen™ Human P4HA3 (aa 80-190) Control Fragment Recombinant Protein

Product Code. 30208897

Brand: Invitrogen™ RP89693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52483 (PA5-52483. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the post-translational formation of 4- hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.

Specifications

• Accession Number: Q7Z4N8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283208
• Name: Human P4HA3 (aa 80-190) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4-PH alpha-3; collagen prolyl 4-hydroxylase alpha 3; collagen prolyl 4-hydroxylase alpha III subunit; collagen prolyl 4-hydroxylase alpha(III); C-P4H alpha III; D930031A02Rik; P4ha3; procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide III; procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3; prolyl 4-hydroxylase subunit alpha 3; prolyl 4-hydroxylase subunit alpha-3; prolyl 4-hydroxylase, alpha polypeptide III; UNQ711/PRO1374
• Common Name: P4HA3
• Gene Symbol: P4ha3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining