Invitrogen™ Human p38 MAPK beta (aa 315-346) Control Fragment Recombinant Protein

Product Code. 30194344

Brand: Invitrogen™ RP109916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145040 (PA5-145040. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPK11 (p38 beta) is a serine/threonine kinase which is involved in a variety of cellular processes, and is activated by proinflammatory cytokines and environmental stress. Mitogen-activated protein kinase 11. The protein encoded by p38 MAPK beta is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase.

Specifications

• Accession Number: Q15759
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5600
• Name: Human p38 MAPK beta (aa 315-346) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MAP kinase 11; MAP kinase p38 beta; MAPK 11; Mapk11; mitogen activated protein kinase 11; mitogen-activated protein kinase 11; Mitogen-activated protein kinase p38 beta; mitogen-activated protein kinase p38-2; OTTHUMP00000196655; p38-2; P38b; p38beta; P38BETA2; Prkm11; protein kinase, mitogen activated kinase, 11, p38beta; SAPK2; SAPK2b; Stress-activated protein kinase 2 b; stress-activated protein kinase-2; stress-activated protein kinase-2 b
• Common Name: p38 MAPK beta
• Gene Symbol: MAPK11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDEPEAEPYDESVEAKERTLEEWKELTYQEVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining