Invitrogen™ Human P2Y8 (aa 268-359) Control Fragment Recombinant Protein

Product Code. 30203767

Brand: Invitrogen™ RP92341

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110672 (PA5-110672. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P2Y8 belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. The gene codifying for this protein is moderately expressed in undifferentiated HL60 cells, and is located at both chromosomes X and Y.

Specifications

• Accession Number: Q86VZ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 286530
• Name: Human P2Y8 (aa 268-359) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G-protein coupled purinergic receptor P2Y8; MGC50878; P2RY8; P2Y purinoceptor 8; P2Y8; purinergic receptor P2Y, G-protein coupled, 8; purinergic receptor P2Y8; RP11-261P4.4
• Common Name: P2Y8
• Gene Symbol: P2RY8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining