Invitrogen™ Human P2X4 (aa 359-388) Control Fragment Recombinant Protein

Product Code. 30182443

Brand: Invitrogen™ RP97746

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83466 (PA5-83466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined.

Specifications

• Accession Number: Q99571
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5025
• Name: Human P2X4 (aa 359-388) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI504491; ATP receptor; ATP-gated cation channel protein; AW555605; D5Ertd444e; ionotropic purinergic receptor; P2 purinergic receptor subtype; P2RX4; P2X purinoceptor 4; P2X receptor, subunit 4; P2X4; P2X4 purinoceptor; P2x4 receptor; P2X4R; Purinergic receptor; purinergic receptor P2X 4; purinergic receptor P2X, ligand gated ion channel, 4; purinergic receptor P2X, ligand-gated ion channel 4; purinergic receptor P2X, ligand-gated ion channel, 4; purinergic receptor P2X4; purinergic receptor P2X4 isoform a; purinergic receptor P2X4 subunit variant 1; purinergic receptor P2X4 subunit variant 2; purinergic receptor P2x4 subunit variant e; purinoceptor P2X4; putative partial extracellular loop region
• Common Name: P2X4
• Gene Symbol: P2RX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YCMKKRLYYREKKYKYVEDYEQGLASELDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining