Invitrogen™ Human P2X3 (aa 184-260) Control Fragment Recombinant Protein

Product Code. 30206750

Brand: Invitrogen™ RP101190

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and may transduce ATP-evoked nociceptor activation. Mouse studies suggest that this receptor is important for peripheral pain responses, and also participates in pathways controlling urinary bladder volume reflexes. It is possible that the development of selective antagonists for this receptor may have a therapeutic potential in pain relief and in the treatment of disorders of urine storage.

Specifications

• Accession Number: P56373
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5024
• Name: Human P2X3 (aa 184-260) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930513E20Rik; ATP receptor; MGC129956; P2RX3; P2X purinoceptor 3; p2X receptor 3; P2X receptor, subunit 3; P2X3; p2X3 purinoceptor; p2xr3; Purinergic receptor; purinergic receptor P2X 3; purinergic receptor P2X, ligand gated ion channel, 3; purinergic receptor P2X, ligand-gated ion channel, 3; purinergic receptor P2X3; purinoceptor P2X3
• Common Name: P2X3
• Gene Symbol: P2rx3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining