Invitrogen™ Human p130Cas (aa 134-235) Control Fragment Recombinant Protein

Product Code. 30197296

Brand: Invitrogen™ RP88613

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83601 (PA5-83601. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The p130Cas (Cas for Crk-associated substrate) is a common cellular target of phosphorylation signal via v-Crk and v-Src oncoproteins. p130Cas has a unique structure that contains a Src homology (SH)-3 domain followed by multiple YXXP motifs and a proline-rich regionp130Cas is implicated in a variety of biological processes including cell adhesion, cell migration, growth factor stimulation, cytokine receptor engagement and bacterial infection. Physiological functions of p130Cas include cardiovascular development, actin filament assembly and Src-induced cell transformation.

Specifications

• Accession Number: P56945
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9564
• Name: Human p130Cas (aa 134-235) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI385681; BCA1; Bcar1; BCAR1 scaffold protein, Cas family member; BCAR1, Cas family scaffold protein; BCAR1, Cas family scaffolding protein; breast cancer anti-estrogen resistance 1; breast cancer anti-estrogen resistance protein 1; Cas; Cas scaffolding protein family member 1; CAS1; CASS1; CRKAS; CRK-associated substrate; Crk-associated substrate p130Cas; OTTHUMP00000174941; p130 Cas; P130CAS; p130Cas (pTyr410); p130Cas (pY410); p130Cas phospho; phospho p130Cas; v-crk-associated tyrosine kinase substrate
• Common Name: p130Cas
• Gene Symbol: BCAR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining