missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human P-Selectin Control Fragment Recombinant Protein

Product Code. 30180536
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180536

Brand: Invitrogen™ RP99385

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82230 (PA5-82230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P-selectin (Selectin P, GMP-140, LECAM3, CD62 antigen-like family member) is a 140 kDa type 1 transmembrane glycoprotein, and is one of the most commonly studied proteins that regulate cell rolling. P-selectin is stored in the Weibel-Palade bodies of endothelial cells, as well as in a-granules of platelets. From there, it can be rapidly brought to the cell surface after exposure to thrombin, histamine, complement 5a, Ca21 ionophores, or adenosine diphosphate. P-selectin protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. P-selectin plays an important role in adhesive processes between leucocytes and endothelial cells, and is a calcium dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens found on neutrophils and monocytes. P-selectin is constitutively expressed in inflammation and contributes to atherogenesis, thrombosis and tissue destruction. Clinically, P-selectin is used to distinguish heparin induced thrombocytopenia with and without thrombosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P16109
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6403
Name Human P-Selectin Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140 kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140 kDa, antigen CD62); selectin, platelet; Selp
Common Name P-Selectin (CD62P)
Gene Symbol SELP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.