Invitrogen™ Human OVOL1 (aa 3-104) Control Fragment Recombinant Protein

Product Code. 30200709

Brand: Invitrogen™ RP102303

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52037 (PA5-52037. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OVOL1 is a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.This gene encodes a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.

Specifications

• Accession Number: O14753
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5017
• Name: Human OVOL1 (aa 3-104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BB147136; CD254; hOvo1; hRANKL2; Ly109l; movo1; mOvo1a; ODF; OPG; OPG ligand; OPGL; OPTB2; osteoclast differentiation factor; Osteoprotegerin ligand; OVO homolog-like 1; OVO homolog-like 1 (Drosophila); ovo like transcriptional repressor 1; ovo like zinc finger 1; Ovo1; Ovol1; OVO-like 1 binding protein; ovo-like 1(Drosophila); ovo-like zinc finger 1; Putative transcription factor Ovo-like 1; RANKL; receptor activator of NF-kappaB ligand; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; sOdf; TNF-related activation-induced cytokine; TNFSF11; TNLG6B; Trance; transcription factor Ovo-like 2; tumor necrosis factor (ligand) superfamily member 11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand 6 B; tumor necrosis factor ligand superfamily member 11; Tumor necrosis factor ligand superfamily member 11, membrane form; Tumor necrosis factor ligand superfamily member 11, soluble form; tumor necrosis factor superfamily member 11; tumor necrosis factor-related activation-induced cytokine
• Common Name: OVOL1
• Gene Symbol: OVOL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining