missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196107

Invitrogen™ Human OVGP1 (aa 332-410) Control Fragment Recombinant Protein

Product Code. 30196107
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196107

Brand: Invitrogen™ RP108804

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Oviductins belong to a family of glycoproteins that have been suggested to play several roles during the early processes of reproduction. OVGP1 is a large carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites within threonine, serine, and proline-rich tandem repeats. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. At least two isoforms of OVGP are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12889
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5016
Name Human OVGP1 (aa 332-410) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 120 kDa; AU016433; AU019448; CHIT5; chitinase 5; EGP; Estrogen-dependent oviduct protein; MOGP; MUC9; mucin 9; mucin-9; OGP; Ovgp1; oviduct glycoprotein; oviduct glycoprotein OGP; Oviductal glycoprotein; oviductal glycoprotein 1; oviductal glycoprotein 1, 120 kD; oviductal glycoprotein 1, 120 kDa; oviductin; oviduct-specific glycoprotein
Common Name OVGP1
Gene Symbol OVGP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPER
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.