Invitrogen™ Human OTX1 (aa 216-281) Control Fragment Recombinant Protein

Product Code. 30195235

Brand: Invitrogen™ RP96555

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62556 (PA5-62556. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Specifications

• Accession Number: P32242
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5013
• Name: Human OTX1 (aa 216-281) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A730044F23Rik; Homeobox protein OTX1; jv; orthodenticle homeobox 1; orthodenticle homolog 1; OTX; Otx1; Otx-1; OTX1X
• Common Name: OTX1
• Gene Symbol: OTX1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining