Invitrogen™ Human OTUD7B (aa 741-811) Control Fragment Recombinant Protein

Artikelnummer. 30198968

missing translation for 'mfr': Invitrogen™ RP91684

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55495 (PA5-55495. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Negative regulator of the non-canonical NF-kappa-B pathway that acts by mediating deubiquitination of TRAF3, an inhibitor of the NF-kappa-B pathway, thereby acting as a negative regulator of B-cell responses. In response to non-canonical NF-kappa-B stimuli, deubiquitinates 'Lys-48'-linked polyubiquitin chains of TRAF3, preventing TRAF3 proteolysis and over-activation of non-canonical NF-kappa-B. Negatively regulates mucosal immunity against infections. Deubiquitinates ZAP70, and thereby regulates T cell receptor (TCR) signaling that leads to the activation of NF-kappa-B (PubMed:26903241). Plays a role in T cell homeostasis and is required for normal T cell responses, including production of IFNG and IL2. Mediates deubiquitination of EGFR (PubMed:22179831). Has deubiquitinating activity toward 'Lys-11', 'Lys-48' and 'Lys-63'-linked polyubiquitin chains (PubMed:27732584). Has a much higher catalytic rate with 'Lys-11'-linked polyubiquitin chains (in vitro); however the physiological significance of these data are unsure (PubMed:27732584). Hydrolyzes both linear and branched forms of polyubiquitin. [UniProt]

Spezifikation

• Accession Number: Q6GQQ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56957
• Name: Human OTUD7B (aa 741-811) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900060B22Rik; 4930463P07Rik; AI462125; cellular zinc finger anti-NF-kappaB Cezanne; cellular zinc finger anti-NF-kappa-B protein; CEZANNE; OTU deubiquitinase 7 B; OTU domain containing 7 B; OTU domain-containing protein 7 B; OTUD7B; RGD1308111; Trabid2; TRAF binding domain containing 2; Za20d1; Zinc finger A20 domain-containing protein 1; zinc finger protein Cezanne; zinc finger, A20 domain containing 1
• Common Name: OTUD7B
• Gene Symbol: OTUD7B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining