Invitrogen™ Human OTUD6B (aa 157-223) Control Fragment Recombinant Protein

Product Code. 30204563

Brand: Invitrogen™ RP93834

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55092 (PA5-55092. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Specifications

• Accession Number: Q8N6M0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51633
• Name: Human OTUD6B (aa 157-223) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2600013N14Rik; AU015433; CGI-77; Deubiquitinase OTUD6B; DUBA5; DUBA-5; ortholog of human CGI-77; OTU domain containing 6 B; OTU domain-containing protein 6 B; Otud6b; RGD1310024
• Common Name: OTUD6B
• Gene Symbol: OTUD6B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining