Invitrogen™ Human OTUD1 (aa 393-466) Control Fragment Recombinant Protein

Product Code. 30201119

Brand: Invitrogen™ RP105951

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65212 (PA5-65212. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Deubiquitinating enzyme that specifically hydrolyzes 'Lys-63'-linked polyubiquitin to monoubiquitin.

Specifications

• Accession Number: Q5VV17
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 220213
• Name: Human OTUD1 (aa 393-466) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DUBA7; DUBA-7; OTDC1; OTU deubiquitinase 1; OTU domain containing 1; OTU domain-containing protein 1; OTUD1
• Common Name: OTUD1
• Gene Symbol: OTUD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining