Invitrogen™ Human OSR2 (aa 48-121) Control Fragment Recombinant Protein

Artikelnummer. 30212372

Marke: Invitrogen™ RP93607

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62606 (PA5-62606. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors.

Spezifikation

• Accession Number: Q8N2R0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116039
• Name: Human OSR2 (aa 48-121) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430409I15Rik; odd-skipped related 2; odd-skipped related transciption factor 2; Osr2; Osr2A; Osr2B; Protein odd-skipped-related 2
• Common Name: OSR2
• Gene Symbol: OSR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TMHMNHWTLGYPNVHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining