Invitrogen™ Human OSGEPL1 (aa 55-185) Control Fragment Recombinant Protein

Product Code. 30195362

Brand: Invitrogen™ RP89224

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56541 (PA5-56541. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OSGEPL1, also known as Qri7, is a 414 amino acid protein that belongs to the KAE1/YgjD family and exists as 3 alternatively spliced isoforms. In tRNAs that have codons beginning with adenine, OSGEPL1 is required for the formation of a threonylcarbamoyl group on adenosine. The gene that encodes OSGEPL1 contains about 16,568 bases and maps to human chromosome 2q32.2. Consisting of 237 million bases, chromosome 2 encodes over 1,400 genes and makes up approximately 8% of the human genome. A number of genetic diseases are linked to genes on chromosome 2. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene. The lipid metabolic disorder sitosterolemia is associated with ABCG5 and ABCG8. An extremely rare recessive genetic disorder, Alstrom syndrome, is due to mutations in the ALMS1 gene.

Specifications

• Accession Number: Q9H4B0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64172
• Name: Human OSGEPL1 (aa 55-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610001M19Rik; AA416452; GCP1; HAMAP-Rule:MF_03179}; N6-L-threonylcarbamoyladenine synthase; OSGEPL1; O-sialoglycoprotein endopeptidase like 1; O-sialoglycoprotein endopeptidase-like 1; O-sialoglycoprotein endopeptidase-like protein 1; O-sialoglycoprotein endopeptidase-like protein 1 {ECO:0000255; probable O-sialoglycoprotein endopeptidase 2; probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial; probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial {ECO:0000255; probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; putative sialoglycoprotease type 2; Qri7; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1; t(6)A37 threonylcarbamoyladenosine biosynthesis protein Osgepl1 {ECO:0000255; tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; tRNA threonylcarbamoyladenosine biosynthesis protein Osgepl1 {ECO:0000255
• Common Name: OSGEPL1
• Gene Symbol: OSGEPL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining