Invitrogen™ Human OSGEP (aa 130-201) Control Fragment Recombinant Protein

Artikelnummer. 30212664

Marke: Invitrogen™ RP109968

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144786 (PA5-144786. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Osgep (O-sialoglycoprotein endopeptidase), also known as GCPL1, is a 335 amino acid protein that is a member of the peptidase M22 family. Osgep specifically cleaves the 31-Arg-l-Asp-32 bond in glycophorin A, but it does not cleave desialylated glycoproteins, unglycosylated proteins or glycoproteins that are only N-glycosylated. Though ubiquitously expressed at low levels, highest levels of Osgep are found in liver, skeletal muscle and kidney. OSGEPL1, also known as Qri7, is a 414 amino acid protein that belongs to the KAE1/YgjD family and exists as three alternatively spliced isoforms. In tRNAs that have codons beginning with adenine, OSGEPL1 is required for the formation of a threonylcarbamoyl group on adenosine.

Spezifikation

• Accession Number: Q9NPF4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55644
• Name: Human OSGEP (aa 130-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500019L24Rik; GCPL1; GCPL-1; HAMAP-Rule:MF_03180}; hOSGEP; KAE1; mOsgep; N6-L-threonylcarbamoyladenine synthase; OSGEP; OSGEP1; O-sialoglycoprotease; O-sialoglycoprotein endopeptidase; O-sialoglycoprotein endopeptidase {ECO:0000255; pasteurella haemolytica metalloprotease homolog with glycoprotein substrates/gpc-like protein 1; probable O-sialoglycoprotein endopeptidase; probable tRNA N6-adenosine threonylcarbamoyltransferase; probable tRNA N6-adenosine threonylcarbamoyltransferase {ECO:0000255; probable tRNA threonylcarbamoyladenosine biosynthesis protein Osgep; PRSMG1; Prsmg1/Gcpl1; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEP; t(6)A37 threonylcarbamoyladenosine biosynthesis protein Osgep {ECO:0000255; tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP; tRNA threonylcarbamoyladenosine biosynthesis protein Osgep {ECO:0000255
• Common Name: OSGEP
• Gene Symbol: OSGEP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining