Invitrogen™ Human OSCAR (aa 140-198) Control Fragment Recombinant Protein

Product Code. 30212585

Brand: Invitrogen™ RP109381

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140332 (PA5-140332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Recently, a novel member of the leukocyte receptor complex (LRC) encoded family has been identified that is expressed specifically in osteoclast (OC). This protein names OC-associated receptor or OSCAR, play critical roles in the regulation of both innate and adaptive immune responses and bone-specific regulator of OC differentiation. Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This protein family plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q8IYS5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126014
• Name: Human OSCAR (aa 140-198) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MGC33613; mOSCAR; mOSCAR-M1; mOSCAR-M2; mOSCAR-M3; ocl178; Oscar; osteoclast associated receptor; osteoclast associated receptor OSCAR-S1; osteoclast associated receptor OSCAR-S2; osteoclast associated, immunoglobulin-like receptor; osteoclast-associated immunoglobulin-like receptor; Osteoclast-associated receptor; osteoclast-associated receptor OSCAR; PIGR3; PIgR-3; poly-Ig receptor 3; polymeric immunoglobulin receptor 3
• Common Name: OSCAR
• Gene Symbol: OSCAR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining