Invitrogen™ Human OSBPL3 (aa 155-257) Control Fragment Recombinant Protein

Product Code. 30202360

Brand: Invitrogen™ RP106189

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65513 (PA5-65513. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF703 belongs to the Elbow/Noc family. It contains 1 C2H2-type zinc finger.ZNF703 may function as a transcriptional repressor.

Specifications

• Accession Number: Q9H4L5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26031
• Name: Human OSBPL3 (aa 155-257) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200014M06Rik; 6720421I08Rik; A530055M08; KIAA0704; ORP3; ORP-3; OSBP3; Osbpl3; OSBP-related protein 3; oxysterol binding protein like 3; oxysterol binding protein-like 3; oxysterol-binding protein-related protein 3; RGD1564287
• Common Name: OSBPL3
• Gene Symbol: OSBPL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining