Invitrogen™ Human OSBP2 (aa 382-465) Control Fragment Recombinant Protein

Product Code. 30201570

Brand: Invitrogen™ RP92362

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54432 (PA5-54432. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Oxysterols are byproducts of cholesterol that can have cytotoxic effects on many cell types. The membrane-bound protein encoded by this gene contains a pleckstrin homology (PH) domain and an oxysterol-binding region. It binds oxysterols such as 7-ketocholesterol and may inhibit their cytotoxicity. Alternate transcriptional splice variants have been observed but have not been fully characterized.

Specifications

• Accession Number: Q969R2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23762
• Name: Human OSBP2 (aa 382-465) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700095P05Rik; C630001G20Rik; Gm244; HLM; KIAA1664; ORP4; ORP-4; Osbp2; OSBPL1; OSBPL4; OSBP-related protein 4; oxysterol binding protein 2; oxysterol binding protein-like 1; oxysterol-binding protein 2; Oxysterol-binding protein-related protein 4; RGD1309479
• Common Name: OSBP2
• Gene Symbol: OSBP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining