Invitrogen™ Human ORP8 (aa 734-864) Control Fragment Recombinant Protein

Product Code. 30195549

Brand: Invitrogen™ RP95155

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51556 (PA5-51556. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9BZF1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114882
• Name: Human ORP8 (aa 734-864) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA536976; AA536995; C730029P18Rik; D330025H14Rik; Kiaa1451; MST120; MSTP120; ORP8; ORP-8; OSBP10; Osbpl8; OSBP-related protein 8; oxysterol binding protein like 8; oxysterol binding protein-like 8; oxysterol-binding protein-related protein 8; RGD1561474
• Common Name: ORP8
• Gene Symbol: OSBPL8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKRNIMALRNHLVSSTPATDY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining