Invitrogen™ Human ORP5 (aa 11-100) Control Fragment Recombinant Protein

Codice prodotto. 30203756

missing translation for 'mfr': Invitrogen™ RP97270

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58507 (PA5-58507. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the oxysterol-binding protein family, a group of intracellular lipid receptors that play a key role in the maintenance of cholesterol balance in the body. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. This gene has been shown to be imprinted, with preferential expression from the maternal allele only in placenta. Transcript variants encoding different isoforms have been identified.

Specifica

• Accession Number: Q9H0X9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114879
• Name: Human ORP5 (aa 11-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DKFZp586H1719; FLJ31948; FLJ42929; KIAA1534; OBPH1; ORP5; ORP-5; OSBPL5; OSBP-related protein 5; oxysterol binding protein like 5; oxysterol binding protein-like 5; oxysterol-binding protein homolog 1; oxysterol-binding protein homologue 1; oxysterol-binding protein-related protein 5
• Common Name: ORP5
• Gene Symbol: OSBPL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining