Invitrogen™ Human ORP2 (aa 283-362) Control Fragment Recombinant Protein

Product Code. 30182170

Brand: Invitrogen™ RP99418

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83621 (PA5-83621. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described.

Specifications

• Accession Number: Q9H1P3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9885
• Name: Human ORP2 (aa 283-362) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C130070J12Rik; DFNA67; DNFA67; FLJ20223; KIAA0772; MGC4307; MGC8342; mKIAA0772; ORP2; ORP-2; Osbpl2; OSBP-related protein 2; oxysterol binding protein like 2; oxysterol binding protein-like 2; oxysterol-binding protein-like 2; oxysterol-binding protein-related protein 2; RP11-157P1.2
• Common Name: ORP2
• Gene Symbol: OSBPL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining