Invitrogen™ Human Orexin Receptor 1 (aa 1-48) Control Fragment Recombinant Protein

Product Code. 30207719

Brand: Invitrogen™ RP90861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.

Specifications

• Accession Number: O43613
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3061
• Name: Human Orexin Receptor 1 (aa 1-48) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Hcrt receptor 1; Hcrtr1; Hctr1; hypocretin (orexin) receptor 1; hypocretin receptor 1; hypocretin receptor type 1; hypocretin receptor-1; Orexin a receptor; orexin receptor 1; orexin receptor type 1; orexin receptor-1; Orexin-1 receptor; O x 1 receptor; O x 1 R; ox-1-R; o x 1-R; OX-R1
• Common Name: Orexin Receptor 1
• Gene Symbol: HCRTR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining