Invitrogen™ Human OPRK1 (aa 339-380) Control Fragment Recombinant Protein

Product Code. 30194093

Brand: Invitrogen™ RP108531

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an opioid receptor, which is a member of the 7 transmembrane-spanning G protein-coupled receptor family. It functions as a receptor for endogenous ligands, as well as a receptor for various synthetic opioids. Ligand binding results in inhibition of adenylate cyclase activity and neurotransmitter release. This opioid receptor plays a role in the perception of pain and mediating the hypolocomotor, analgesic and aversive actions of synthetic opioids. Variations in this gene have also been associated with alcohol dependence and opiate addiction. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.

Specifications

• Accession Number: P41145
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4986
• Name: Human OPRK1 (aa 339-380) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: kappa opioid receptor; kappa-type opioid receptor; KOPR1; KOR; K-OR-1; KOR-1; MSL-1; Opiate receptor, kappa-1; opioid receptor kappa 1; opioid receptor, kappa 1; opioid receptor, kappa 2; OPRK; OPRK1; Oprk2; Ork1; R21; Ror-d
• Common Name: OPRK1
• Gene Symbol: OPRK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining